6.612 HP 0.011 HIVE 0.002 HBD
6.6 HP
58.6
108 moons
max_mana | 13,004,078,730 |
---|---|
current_mana | 13,004,078,730 |
current_pct | 100 |
adjustment | "1.216 HP" |
comment | 1.2 |
---|---|
vote | 0.08 |
transfer | 0.2 |
Id | 247,407 | ||||||
---|---|---|---|---|---|---|---|
Name | ahtaroo | ||||||
Posting json metadata | "{"profile":{"name":"A Tar Oo"}}" | ||||||
Proxy | "" | ||||||
Previous owner update | 2017-07-10 04:20:00 | ||||||
Last owner update | 2018-03-23 16:06:51 | ||||||
Last account update | 2018-06-09 03:49:15 | ||||||
Created | 2017-07-08 17:22:09 | ||||||
Mined | false | ||||||
Recovery account | steem | ||||||
Last account recovery | 1970-01-01 00:00:00 | ||||||
Reset account | null | ||||||
Post count | 2,217 | ||||||
Can vote | true | ||||||
Downvote manabar |
| ||||||
Balance | 0.011 HIVE | ||||||
Savings balance | 0.000 HIVE | ||||||
Hbd balance | 0.002 HBD | ||||||
Hbd seconds | 0 | ||||||
Hbd seconds last update | 2018-08-16 09:55:00 | ||||||
Hbd last interest payment | 2018-08-16 09:55:00 | ||||||
Savings hbd balance | 0.000 HBD | ||||||
Savings hbd seconds | 0 | ||||||
Savings hbd seconds last update | 1970-01-01 00:00:00 | ||||||
Savings hbd last interest payment | 1970-01-01 00:00:00 | ||||||
Savings withdraw requests | 0 | ||||||
Reward hbd balance | 0.000 HBD | ||||||
Reward hive balance | 0.000 HIVE | ||||||
Reward vesting balance | 2.030564 VESTS | ||||||
Reward vesting hive | 0.001 HIVE | ||||||
Vesting shares | 10,983.329757 VESTS | ||||||
Delegated vesting shares | 0.000000 VESTS | ||||||
Received vesting shares | 0.000000 VESTS | ||||||
Vesting withdraw rate | 0.000000 VESTS | ||||||
Post voting power | 10,983.329757 VESTS | ||||||
Next vesting withdrawal | "" | ||||||
Withdrawn | 0 | ||||||
To withdraw | 0 | ||||||
Withdraw routes | 0 | ||||||
Pending transfers | 0 | ||||||
Curation rewards | 10,969 | ||||||
Posting rewards | 579,292 | ||||||
Proxied vsf votes | 0.000000 VESTS | ||||||
Witnesses voted for | 0 | ||||||
Last post | 2018-05-11 12:04:45 | ||||||
Last root post | 2018-02-02 16:28:09 | ||||||
Last vote time | 2018-06-23 03:13:48 | ||||||
Pending claimed accounts | 0 | ||||||
Governance vote expiration ts | 1969-12-31 23:59:59 | ||||||
Delayed votes | [] | ||||||
Open recurrent transfers | 0 | ||||||
Reputation | 5,350,629,597,479 | ||||||
Sbd balance | 0.002 HBD | ||||||
Savings sbd balance | 0.000 HBD |
{"profile":{"name":"A Tar Oo"}}
Owner | |
---|---|
STM7VmdVtt7Q6Q4UWgdckwWNsQph7czPEGFwnHWM4bvRiETNdMNc9 |
Active | |
---|---|
STM5wyEHLVyHcJ1vgsk28aHrVMpiXez6QSVfZ9oEBX8h3ALJM5m2o |
Posting | |||
---|---|---|---|
dtube.app | 1 | 33.3% | |
busy.app | 1 | 33.3% | |
STM74z77Zuwhw78p8mRfRQCaf8ECNgo2xq114Mv2KXn6CAic5vV72 | 1 | 33.3% | |
Threshold | 1 | 33.3% |
Memo | |
---|---|
STM68JMS15Fbuc4vvQFZV3rv7dZECPfaUmi1H9QDRjbdBv8tuW6fu |
I've noticed you have a recovery account set to @steem, which is a security issue! Review your recovery account if you don't want to lose your tokens! Read more: https://peakd.com/witness-update/@engrave/review-your-recovery-account-if-you-dont-want-to-lose-your-assets
Time is running out, claim your DTube account now before anyone else can! Login at https://d.tube
Hy @ahtaroo check out https://steemdetective.com
Hello ★ Make the post more popular and find the new followers ★ Resteem to 16.000+ followers ★ + 100 upvote + upvote hotlist ★ Send 1 SBD or STEEM to @hotlist , URL in the memo ★ Service Active
from | smitop |
---|---|
request_id | 12,693 |
to | ahtaroo |
amount | 0.001 HBD |
memo | "Hi, it looks like you're not voting for any witnesses. Witnesses help secure the Steem network. You should vote for some, at https://steemit.com/~witnesses, or by pressing 'Vote for witnesses' in the Steemit sidebar (top right corner). I'm a bot." |
from | smitop |
---|---|
request_id | 12,695 |
to | ahtaroo |
amount | 0.001 HBD |
memo | "Hi, it looks like you're not voting for any witnesses. Witnesses help secure the Steem network. You should vote for some, at https://steemit.com/~witnesses, or by pressing 'Vote for witnesses' in the Steemit sidebar (top right corner). I'm a bot." |
voter | ahtaroo |
---|---|
author | steemitarrman |
permlink | mngkmlame-lktpak |
weight | 210 |
rshares | 219,666,595 |
total_vote_weight | 418,704 |
pending_payout | 0.411 HBD |
voter | ahtaroo |
---|---|
author | steemitarrman |
permlink | tayk-khyathyakheyaundefinedwng |
weight | 203 |
rshares | 219,666,595 |
total_vote_weight | 65,731 |
pending_payout | 0.011 HBD |
voter | ahtaroo |
---|---|
author | thuzartun |
permlink | elakdaanko-kan-kan-khanmy |
weight | 1,648 |
rshares | 219,666,595 |
total_vote_weight | 45,091 |
pending_payout | 0.004 HBD |
voter | ahtaroo |
---|---|
author | thuzartun |
permlink | mit-esay-ekang-epundefinedyakhng-eaundefined |
weight | 52 |
rshares | 219,666,595 |
total_vote_weight | 1,648,238 |
pending_payout | 6.611 HBD |
voter | ahtaroo |
---|---|
author | steemitarrman |
permlink | kundefinedtpud-yae-thmong |
weight | 346 |
rshares | 219,666,595 |
total_vote_weight | 52,861 |
pending_payout | 0.006 HBD |
voter | ahtaroo |
---|---|
author | thuzartun |
permlink | sit |
weight | 446 |
rshares | 219,666,595 |
total_vote_weight | 28,388 |
pending_payout | 0.002 HBD |
voter | ahtaroo |
---|---|
author | thuzartun |
permlink | the-blocktrades-world-cup-or-my-selections |
weight | 787 |
rshares | 219,666,595 |
total_vote_weight | 30,601 |
pending_payout | 0.002 HBD |
voter | ahtaroo |
---|---|
author | steemitarrman |
permlink | thtiyaenyayaundefinedne-lundefined-elak-yang-mpong-saong-lokhepa |
weight | 103 |
rshares | 216,371,596 |
total_vote_weight | 1,042,197 |
pending_payout | 3.213 HBD |
voter | ahtaroo |
---|---|
author | thuzartun |
permlink | atak-eaak-ptipk |
weight | 52 |
rshares | 219,666,595 |
total_vote_weight | 2,186,118 |
pending_payout | 14.111 HBD |
voter | ahtaroo |
---|---|
author | steemitarrman |
permlink | undefinednpeaangenloktapa |
weight | 47 |
rshares | 219,666,595 |
total_vote_weight | 52,496 |
pending_payout | 0.009 HBD |
voter | ahtaroo |
---|---|
author | thuzartun |
permlink | my-self |
weight | 419 |
rshares | 219,666,595 |
total_vote_weight | 292,144 |
pending_payout | 0.316 HBD |
voter | ahtaroo |
---|---|
author | steemitarrman |
permlink | 5dxsgr-m |
weight | 1,642 |
rshares | 215,273,263 |
total_vote_weight | 78,127 |
pending_payout | 0.023 HBD |
voter | ahtaroo |
---|---|
author | steemitarrman |
permlink | tnpaotaattpundefineds |
weight | 838 |
rshares | 219,666,595 |
total_vote_weight | 99,403 |
pending_payout | 0.034 HBD |
voter | ahtaroo |
---|---|
author | steemitarrman |
permlink | ekhangs-m-wundefinedtha |
weight | 67 |
rshares | 219,666,595 |
total_vote_weight | 50,854 |
pending_payout | 0.009 HBD |
voter | ahtaroo |
---|---|
author | steemitarrman |
permlink | m |
weight | 729 |
rshares | 219,666,595 |
total_vote_weight | 51,775 |
pending_payout | 0.009 HBD |
voter | ahtaroo |
---|---|
author | steemitarrman |
permlink | ae-kangtyaaundefined |
weight | 72 |
rshares | 219,666,595 |
total_vote_weight | 51,770 |
pending_payout | 0.010 HBD |
voter | ahtaroo |
---|---|
author | steemitarrman |
permlink | keyae-khunsyak-undefinedmymkhunsyak |
weight | 4,007 |
rshares | 1,050,351,100 |
total_vote_weight | 192,665 |
pending_payout | 0.159 HBD |
voter | ahtaroo |
---|---|
author | steemitarrman |
permlink | atulktye-elundefinedk-kpaso |
weight | 1,452 |
rshares | 1,050,351,100 |
total_vote_weight | 56,959 |
pending_payout | 0.015 HBD |
voter | ahtaroo |
---|---|
author | steemitarrman |
permlink | thnykhan |
weight | 925 |
rshares | 1,050,351,100 |
total_vote_weight | 99,201 |
pending_payout | 0.040 HBD |
author | ahtaroo |
---|---|
permlink | re-redboy09-re-steemitarrman-ki-eletyyaptetamwala-20180511t120443636z |
voter | ahtaroo |
---|---|
author | steemitarrman |
permlink | alupne-aim-ka-entaongm-ba0 |
weight | 448 |
rshares | 1,881,035,605 |
total_vote_weight | 1,703,406 |
pending_payout | 12.717 HBD |
voter | ahtaroo |
---|---|
author | steemitarrman |
permlink | happy-mother-s-day |
weight | 944 |
rshares | 1,880,994,903 |
total_vote_weight | 113,464 |
pending_payout | 0.058 HBD |
voter | ahtaroo |
---|---|
author | steemitarrman |
permlink | ki-eletyyaptetamwala |
weight | 1,120 |
rshares | 2,711,679,409 |
total_vote_weight | 126,850 |
pending_payout | 0.087 HBD |
voter | ahtaroo |
---|---|
author | steemitarrman |
permlink | ataa |
weight | 1,275 |
rshares | 2,711,435,123 |
total_vote_weight | 118,019 |
pending_payout | 0.079 HBD |
author | ahtaroo |
---|---|
permlink | re-steemitarrman-mitesay-20180501t133851808z |
voter | ahtaroo |
---|---|
author | steemitarrman |
permlink | lytlpsyundefinedthnmy |
weight | 20,272 |
rshares | 2,657,206,421 |
total_vote_weight | 86,047 |
pending_payout | 0.042 HBD |
voter | ahtaroo |
---|---|
author | steemitarrman |
permlink | criticism |
weight | 2,137 |
rshares | 2,711,435,123 |
total_vote_weight | 86,688 |
pending_payout | 0.043 HBD |
voter | ahtaroo |
---|---|
author | steemitarrman |
permlink | sathngkhnyapngp-thng-kaeya |
weight | 28,988 |
rshares | 3,542,119,629 |
total_vote_weight | 74,212 |
pending_payout | 0.035 HBD |
voter | ahtaroo |
---|---|
author | steemitarrman |
permlink | mitesay |
weight | 1,396 |
rshares | 3,542,119,629 |
total_vote_weight | 122,668 |
pending_payout | 0.101 HBD |
voter | ahtaroo |
---|---|
author | steemitarrman |
permlink | kelmikhngundefined-thitaayamyaundefinedkundefined |
weight | 3,378 |
rshares | 3,542,119,629 |
total_vote_weight | 402,764 |
pending_payout | 1.024 HBD |
voter | ahtaroo |
---|---|
author | kyawhlaing |
permlink | lymsyaa-lyamtksaun |
weight | 6,756 |
rshares | 3,542,119,629 |
total_vote_weight | 326,569 |
pending_payout | 0.709 HBD |
voter | ahtaroo |
---|---|
author | kyawhlaing |
permlink | eos-usd-18-8 |
weight | 6,519 |
rshares | 3,418,145,442 |
total_vote_weight | 215,279 |
pending_payout | 0.272 HBD |
voter | ahtaroo |
---|---|
author | kyawhlaing |
permlink | emundefinedlngundefinedkeyaangyakhny |
weight | 5,996 |
rshares | 3,471,277,236 |
total_vote_weight | 393,840 |
pending_payout | 0.853 HBD |
voter | ahtaroo |
---|---|
author | kyawhlaing |
permlink | thyamwyapasmy |
weight | 9,182 |
rshares | 3,542,119,629 |
total_vote_weight | 200,937 |
pending_payout | 0.226 HBD |
voter | ahtaroo |
---|---|
author | steemitarrman |
permlink | where-am-i |
weight | 1,681 |
rshares | 4,372,804,134 |
total_vote_weight | 77,061 |
pending_payout | 0.032 HBD |
★★★ Hi! Wishes success in your creativity on Steemit! If your post hasn't been noticed , @resteemboss can help you. Send 1.5 SBD or STEEM to @resteemboss or to any of 4 services, and we will make resteem to 55.000+ followers, + 45 upvote , your post will be surely noticed . RESTEEM BOT 4 in 1 . @bigshot + @hotlist + @re-blog + @artcity . Service Active ★★★
voter | ahtaroo |
---|---|
author | steemitarrman |
permlink | yawikhepautundefinedpa |
weight | 970 |
rshares | 4,372,763,392 |
total_vote_weight | 77,061 |
pending_payout | 0.029 HBD |
voter | ahtaroo |
---|---|
author | steemitarrman |
permlink | love-you |
weight | 3,235 |
rshares | 4,372,641,157 |
total_vote_weight | 70,034 |
pending_payout | 0.024 HBD |
voter | ahtaroo |
---|---|
author | kyawhlaing |
permlink | trx-usd |
weight | 16,940 |
rshares | 4,812,850,068 |
total_vote_weight | 198,026 |
pending_payout | 0.165 HBD |
voter | ahtaroo |
---|---|
author | kyawhlaing |
permlink | happy-new-year-myanmar |
weight | 17,020 |
rshares | 4,916,911,691 |
total_vote_weight | 198,343 |
pending_payout | 0.166 HBD |
voter | ahtaroo |
---|---|
author | kyawhlaing |
permlink | 25-free-upvote |
weight | 9,577 |
rshares | 5,020,973,314 |
total_vote_weight | 273,714 |
pending_payout | 0.353 HBD |
voter | ahtaroo |
---|---|
author | kyawhlaing |
permlink | doge-usd |
weight | 14,822 |
rshares | 5,099,019,531 |
total_vote_weight | 201,236 |
pending_payout | 0.173 HBD |
voter | ahtaroo |
---|---|
author | kyawhlaing |
permlink | pn-k-ikte-minkel |
weight | 2,481 |
rshares | 5,203,081,154 |
total_vote_weight | 953,320 |
pending_payout | 4.248 HBD |
voter | ahtaroo |
---|---|
author | aungzawhtwe |
permlink | free-post-promotion-season-1 |
weight | 4,962 |
rshares | 5,203,040,388 |
total_vote_weight | 470,106 |
pending_payout | 0.849 HBD |
voter | ahtaroo |
---|---|
author | steemitarrman |
permlink | enakmthyaetabau |
weight | 5,667 |
rshares | 5,942,214,820 |
total_vote_weight | 416,897 |
pending_payout | 0.491 HBD |
voter | ahtaroo |
---|---|
author | steemitarrman |
permlink | eyawehangaemy-yamnmayyntany-3 |
weight | 5,754 |
rshares | 6,032,705,401 |
total_vote_weight | 411,407 |
pending_payout | 0.474 HBD |
voter | ahtaroo |
---|---|
author | steemitarrman |
permlink | bevy |
weight | 11,506 |
rshares | 6,032,705,401 |
total_vote_weight | 291,788 |
pending_payout | 0.246 HBD |
Hi ! You think your post is underrated ? Send 0.5 SBD or STEEM to @artcity , Resteem to 11.000+ Followers , +15 Upvote , ArtCity 100% Upvote . URL as Memo
voter | ahtaroo |
---|---|
author | kokyawzinphyo |
permlink | yamnmath-k-npyundefinedta |
weight | 3,272 |
rshares | 6,862,166,351 |
total_vote_weight | 901,781 |
pending_payout | 2.385 HBD |
voter | ahtaroo |
---|---|
author | steemitarrman |
permlink | eyawehangaemy-yamnmayyntany-2 |
weight | 26,170 |
rshares | 6,860,330,647 |
total_vote_weight | 151,953 |
pending_payout | 0.057 HBD |
Someone has downvote you? Do you want to revenge? I represent service of downvote. Send 2 SBD or STEEM to @kaaser, and we for you will revenge. Downvote will be made from three accounts with reputation 72, 69, 65 and with a general force of 480.000 SP. For anonymity, send URL of the account which needs to be downvote on mail - dzexxx01@gmail.com + your name from which you have sent SBD or STEEM.
voter | ahtaroo |
---|---|
author | steemitarrman |
permlink | good-bye |
weight | 3,489 |
rshares | 6,860,330,647 |
total_vote_weight | 138,847 |
pending_payout | 0.049 HBD |
voter | ahtaroo |
---|---|
author | kokyawzinphyo |
permlink | e-y-i-wng-th-k-n-c411b8b538e3c |
weight | 7,054 |
rshares | 6,860,330,647 |
total_vote_weight | 101,989 |
pending_payout | 0.024 HBD |
voter | ahtaroo |
---|---|
author | steemitarrman |
permlink | sipyaeyathmaetyk-pnyayawngetytakthathla |
weight | 12,300 |
rshares | 6,448,710,808 |
total_vote_weight | 213,933 |
pending_payout | 0.123 HBD |
voter | ahtaroo |
---|---|
author | kokyawzinphyo |
permlink | aundefinedstela-c1b93d62a2064 |
weight | 7,851 |
rshares | 6,551,615,768 |
total_vote_weight | 118,660 |
pending_payout | 0.039 HBD |
voter | ahtaroo |
---|---|
author | nainghtookhant |
permlink | re-kokyawzinphyo-aundefinedstela-c1b93d62a2064-20180331t093324196z |
weight | 871 |
rshares | 6,688,822,381 |
total_vote_weight | 251,204 |
pending_payout | 0.178 HBD |
voter | ahtaroo |
---|---|
author | steemitarrman |
permlink | eyawehangaemya-ws-yamnmayyntany-1 |
weight | 12,823 |
rshares | 6,723,124,034 |
total_vote_weight | 248,615 |
pending_payout | 0.174 HBD |
voter | ahtaroo |
---|---|
author | steemitarrman |
permlink | taking-note |
weight | 23,395 |
rshares | 6,860,330,647 |
total_vote_weight | 199,383 |
pending_payout | 0.101 HBD |
voter | ahtaroo |
---|---|
author | kyawhlaing |
permlink | atnglo-la-knythny |
weight | 14,156 |
rshares | 7,421,554,028 |
total_vote_weight | 230,773 |
pending_payout | 0.149 HBD |
voter | ahtaroo |
---|---|
author | kyawhlaing |
permlink | mwnknte-pt0netngtskhuko-pantipa |
weight | 14,375 |
rshares | 7,536,914,972 |
total_vote_weight | 242,171 |
pending_payout | 0.167 HBD |
voter | ahtaroo |
---|---|
author | steem-myanmar |
permlink | 31-3-2018senen-aupsu-2-mwpyaomoyawngtngyan-msc-mw-promotion-thithn-epethaaekangundefinedtha |
weight | 14,669 |
rshares | 7,690,729,563 |
total_vote_weight | 307,616 |
pending_payout | 0.265 HBD |
author | ahtaroo |
---|---|
permlink | re-steemitarrman-dream-to-come-true-20180322t144054403z |
voter | ahtaroo |
---|---|
author | kokyawzinphyo |
permlink | tkyakutholpe |
weight | 2,599 |
rshares | 7,690,688,761 |
total_vote_weight | 104,982 |
pending_payout | 0.030 HBD |
voter | ahtaroo |
---|---|
author | nainghtookhant |
permlink | mngthipundefineds-fd2b552b08576 |
weight | 29,368 |
rshares | 7,690,688,761 |
total_vote_weight | 127,612 |
pending_payout | 0.048 HBD |
voter | ahtaroo |
---|---|
author | steemitarrman |
permlink | dutiya-kim-koyko-thtthyayakhng |
weight | 3,436 |
rshares | 7,690,688,761 |
total_vote_weight | 111,153 |
pending_payout | 0.036 HBD |
author | ahtaroo |
---|---|
permlink | re-steemitarrman-steemit-mitesayundefinedtho-upvote-group-paye-snyyan-a-kanyap-undefinedk-20180321t000020178z |
voter | ahtaroo |
---|---|
author | kokyawzinphyo |
permlink | rule-and-value-88bf83b40535c |
weight | 25,276 |
rshares | 7,688,566,803 |
total_vote_weight | 105,727 |
pending_payout | 0.035 HBD |
voter | ahtaroo |
---|---|
author | steemitarrman |
permlink | knym-teel |
weight | 10,334 |
rshares | 7,688,566,803 |
total_vote_weight | 106,549 |
pending_payout | 0.036 HBD |
voter | ahtaroo |
---|---|
author | kokyawzinphyo |
permlink | myanmar-steemit-community-e3b0b56def3e8 |
weight | 32,343 |
rshares | 7,688,566,803 |
total_vote_weight | 124,309 |
pending_payout | 0.053 HBD |
voter | ahtaroo |
---|---|
author | nainghtookhant |
permlink | respect-undefinedptt-kpundefineds-89e647a99a03f |
weight | 4,755 |
rshares | 7,688,566,803 |
total_vote_weight | 113,065 |
pending_payout | 0.043 HBD |
voter | ahtaroo |
---|---|
author | steemitarrman |
permlink | protein |
weight | 27,022 |
rshares | 7,688,566,803 |
total_vote_weight | 198,915 |
pending_payout | 0.126 HBD |
voter | ahtaroo |
---|---|
author | kokyawzinphyo |
permlink | undefinedundefined-ki-undefinedlngenmiyae-eed33a24b341 |
weight | 7,338 |
rshares | 8,518,516,700 |
total_vote_weight | 105,412 |
pending_payout | 0.037 HBD |
voter | ahtaroo |
---|---|
author | steemitarrman |
permlink | dream-to-come-true |
weight | 16,244 |
rshares | 8,516,639,040 |
total_vote_weight | 216,275 |
pending_payout | 0.157 HBD |
voter | ahtaroo |
---|---|
author | kokyawzinphyo |
permlink | lungyundefined-wng-muysesawa-a-yaay-72e087ebe9c63 |
weight | 9,042 |
rshares | 8,516,639,040 |
total_vote_weight | 136,497 |
pending_payout | 0.065 HBD |